PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 237aa    MW: 26245.6 Da    PI: 4.8526
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27824.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.6e-16243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
        PK27824.1  2 TPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.292147IPR017930Myb domain
CDDcd001676.39E-13143No hitNo description
SMARTSM007171.1E-11145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-20244IPR009057Homeodomain-like
PfamPF002492.1E-14242IPR001005SANT/Myb domain
SuperFamilySSF466892.89E-12248IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MTPQEERLVL ELHSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQEK KKSTTTTTSN  60
SSSSSSSSSP PPDHDVSSPS QSSSSSNITT VESLPFPDST TGVESFYDTG GRVVSAYDNR  120
GHDKMKTEAK NHIEDEQQTA AAAVAGCYSM DDIWKEISLP EEGVYNCNNL TSTPLIAAAE  180
PSPPAWDEYY CSDSLWINNL DEEVSNKSRG FTQTTATAIN DPFNYACFDY GGAFLTG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112913.13e-56Transcription factor
TrEMBLW9SC383e-56W9SC38_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-33myb domain protein 48